PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g039230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 180aa    MW: 20918.7 Da    PI: 9.8275
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g039230.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.88.9e-1972127257
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +k+ ++t+eql+ Le+ F+++ +++ +++ +L+k+lgL+ rq+ vWFqNr+a++k+
  Csa06g039230.1  72 KKKKKMTSEQLKFLERSFQEDIKLNPDRKMKLSKELGLQPRQIAVWFQNRKARWKN 127
                     78999*************************************************95 PP

2HD-ZIP_I/II111.94.1e-3672163192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+++++eq+k+LE+sF+e+ kL+p+rK++l++eLglqprq+avWFqnr+AR+k+kqlE+ ye+L++++d +++e+e L++e  +L++ ++
  Csa06g039230.1  72 KKKKKMTSEQLKFLERSFQEDIKLNPDRKMKLSKELGLQPRQIAVWFQNRKARWKNKQLEHLYESLRQEFDVVSREKELLQEELIQLKSMIR 163
                     59**************************************************************************************8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-2056130IPR009057Homeodomain-like
PROSITE profilePS5007117.45968128IPR001356Homeobox domain
SMARTSM003897.5E-1870132IPR001356Homeobox domain
PfamPF000464.0E-1672127IPR001356Homeobox domain
CDDcd000869.34E-1578129No hitNo description
Gene3DG3DSA:1.10.10.605.2E-2078128IPR009057Homeodomain-like
PRINTSPR000317.3E-599108IPR000047Helix-turn-helix motif
PROSITE patternPS000270103126IPR017970Homeobox, conserved site
PRINTSPR000317.3E-5108124IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MEYWSSSFID GASSSNFISP FYNLDRFPGN QDNRCISSGT MVGAQQGMLH VPLQMVESGY  60
GEESNNNNGQ QKKKKKMTSE QLKFLERSFQ EDIKLNPDRK MKLSKELGLQ PRQIAVWFQN  120
RKARWKNKQL EHLYESLRQE FDVVSREKEL LQEELIQLKS MIRENGSNKK MQNWGKACS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00049PBMTransfer from AT2G36610Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0565691e-99DQ056569.1 Arabidopsis thaliana homeobox-leucine zipper family protein (At2g36610) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010516885.11e-130PREDICTED: homeobox-leucine zipper protein ATHB-22-like
SwissprotQ4PSR71e-110ATB22_ARATH; Homeobox-leucine zipper protein ATHB-22
TrEMBLR0HRP81e-119R0HRP8_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0004_21631e-113(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16602888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36610.14e-79homeobox protein 22